Domain Names
51585 Domain Names
Rank
1st Rank.
Domain Name Dispute Cases with Decision: TRANSFER
You can also use the search page to filter the cases with decision: Transfer.
Case NoDomain NameDecisionDecision Date
D2018-2089 rakatan.com Transfer Oct. 11, 2018
D2018-2080 axiscamerasystemsatlanta.com Transfer Oct. 19, 2018
D2018-2013 manage-mytelus.com Transfer Oct. 12, 2018
D2018-1966 breguet.store, blancpain.store Transfer Oct. 15, 2018
D2018-1965 nintendotencent.com Transfer Oct. 17, 2018
D2018-1960 badgleymischkaswimwear.com, badgleymischkaswim.com Transfer -
D2018-1953 skyscannerusa.com Transfer -
D2018-1947 peltonandcrane.com Transfer Oct. 10, 2018
D2018-1937 lorealfranchise.com Transfer Oct. 12, 2018
D2018-1932 weixinzhi.com Transfer -
D2018-1927 klarnabitcoin.com Transfer -
D2018-1922 kraftheinzcornpany.com Transfer Sept. 27, 2018
D2018-1921 ibmmonitors.net Transfer Oct. 1, 2018
D2018-1920 foreverloveibm.com Transfer Oct. 1, 2018
D2018-1913 grouperexel.com Transfer Oct. 12, 2018
D2018-1911 virginluxuryhotels.com Transfer Oct. 18, 2018
D2018-1897 secure-gap.com Transfer Oct. 16, 2018
D2018-1892 mandginvestment.com Transfer -
D2018-1890 dreamstimes.com Transfer Oct. 5, 2018
D2018-1889 huntbrotherspizza.online Transfer Sept. 29, 2018
D2018-1884 dtccglobal.com Transfer Oct. 2, 2018
D2018-1883 breitlingstore.com, breitlingshop.com, breitlingboutique.com Transfer Sept. 21, 2018
D2018-1882 sofitelrabatjardindesroses.website, sofitelmarrakechpalaisimperial.website, sofitelmarrakechloungeandspa.website and 15 others... Transfer Oct. 5, 2018
D2018-1879 iqosturk.com Transfer Sept. 28, 2018
D2018-1876 bartec.com Transfer Oct. 2, 2018