All Domain Name Dispute Cases

There are total 41,340 cases.
Case NoDomain NameDecisionDecision Date
D2018-1883 breitlingstore.com, breitlingshop.com, breitlingboutique.com Case active -
D2018-1882 sofitelrabatjardindesroses.website, sofitelmarrakechpalaisimperial.website, sofitelmarrakechloungeandspa.website and 15 others... Case active -
D2018-1881 thecapitalgroupco.com, capgroupco.com Case active -
D2018-1880 allybank.top, allybank.site, allybank.online Case active -
D2018-1879 iqosturk.com Case active -
D2018-1878 fr-robertet.com Case active -
D2018-1877 vulkanorigonline1.com, vulkanorigonline.com, vulkanoriginalplay.com and 7 others... Case active -
D2018-1876 bartec.com Case active -
D2018-1875 valero.vip Case active -
D2018-1874 pmiukraine.org Case active -
D2018-1873 iqosmy.org, iqosmy.net Case active -
D2018-1872 blackiqos.com Case active -
D2018-1871 mutuelcreditinvest.com Case active -
D2018-1870 mifare.store, mifare.shop Case active -
D2018-1869 iqos456.com Case active -
D2018-1868 iqos-plus.com Case active -
D2018-1867 unifi-ip.com Case active -
D2018-1866 divorcepaperswriter.com Case active -
D2018-1865 cbdhempmeds.net Case active -
D2018-1864 phillpmorris.com Case active -
D2018-1863 nmglego.com Case active -
D2018-1862 freetokenschaturbate.com Case active -
D2018-1861 dreamstine.com Case active -
D2018-1860 mediurn.com Case active -
D2018-1859 rnediurn.com, medium-news.com, medium-airdrop.com Case active -
D2018-1858 gotmilkyet.com Case active -
D2018-1857 elliotttmgmt.com Case active -
D2018-1856 aex88.com, aex-global.com, aex.com Case active -
D2018-1855 credit-mutuel-confirmation-mobile.com Case active -
D2018-1854 ilbm.com, br-ilbm.com, br-ibm.com Case active -
D2018-1853 eternalfleur.com Case active -
D2018-1852 buyduromineonline.com Case active -
D2018-1851 gerbentrademark.com Case active -
D2018-1850 fashionphileoutlet.com Case active -
D2018-1849 temaris.com Case active -
D2018-1848 starstable-hack.win Case active -
D2018-1847 proximus.tech Case active -
D2018-1846 osramd.com Case active -
D2018-1845 catmarbre.com, catindustrie.com Case active -
D2018-1844 credit-mutuel.tech Case active -
D2018-1843 tjarcelormittal.com Case active -
D2018-1842 bestiqos.com Case active -
D2018-1841 bayernow.com Case active -
D2018-1840 boycottbayer.com Case active -
D2018-1839 lincolnnavigator.com Case active -
D2018-1838 fdmag.com Case active -
D2018-1837 nycifgroup.com Case active -
D2018-1836 duromineonline.com Case active -
D2018-1835 higeen.com Case active -
D2018-1834 buscemi-sneakers.com, buscemi-sale.com, buscemi-outlet.com and buscemi-online.com Case active -