Dreyfus & Associés

268 Cases

267 Cases (460 domain names) as Complainant Representative.

1 Cases (1 domain names) as Respondent Representative.

6th Rank as Complainant Representative, 1765th Rank as Respondent Representative.

As Complainant Representative
As Respondent Representative

Cases Over Years
Decisions

Cases Over Years as Complainant Representative

Decisions as Complainant Representative

Cases Over Years
Decisions

Cases Over Years as Respondent Representative

Decisions as Respondent Representative

Domain Name Dispute Cases with DREYFUS & ASSOCIÉS as Representative

You can also use the search page to filter the cases (as complainant representative / as respondent representative).

Case No	Party	Domain Name	Decision	Decision Date
D2018-2228	Complainant	michelin-health.com	Transfer	Nov. 9, 2018
D2018-2203	Complainant	carrefourt.com	Transfer	Nov. 13, 2018
D2018-2145	Complainant	moncompte-carrefour.net	Transfer	Nov. 8, 2018
D2018-2140	Complainant	carrefour-moncompte.info	Transfer	Nov. 9, 2018
D2018-2052	Complainant	carrefourespaceclient.com	Transfer	Nov. 8, 2018
D2018-1949	Complainant	banque-carefour.net, banque-carefour.com	Transfer	Nov. 5, 2018
D2018-1938	Complainant	carrefour.gift	Transfer	-
D2018-1937	Complainant	lorealfranchise.com	Transfer	Oct. 12, 2018
D2018-1882	Complainant	sofitelrabatjardindesroses.website, sofitelmarrakechpalaisimperial.website, sofitelmarrakechloungeandspa.website and 15 others...	Transfer	Oct. 5, 2018
D2018-1754	Complainant	accor.group	Transfer	Sept. 19, 2018
D2018-1736	Complainant	swissotel-dubai.com	Transfer	Sept. 10, 2018
D2018-1733	Complainant	accordeals.com, accordeal.com	Transfer	Oct. 3, 2018
D2018-1730	Complainant	voltaren.xyz	Transfer	Sept. 14, 2018
D2018-1718	Complainant	michelinsh.com	Transfer	-
D2018-1717	Complainant	hotelnovotels.com	Transfer	Oct. 7, 2018
D2018-1682	Complainant	michelinblockchain.xyz	Transfer	Nov. 2, 2018
D2018-1645	Complainant	fr-accorhotels.com	Transfer	Sept. 6, 2018
D2018-1630	Complainant	laguiadelmichelin.com	Transfer	Sept. 14, 2018
D2018-1626	Complainant	loréal.business	Transfer	Oct. 10, 2018
D2018-1623	Complainant	sofitel.pub	Transfer	Aug. 29, 2018
D2018-1622	Complainant	voltaren.store	Transfer	Sept. 12, 2018
D2018-1609	Complainant	lorealduty.com	Transfer	Aug. 31, 2018
D2018-1608	Complainant	esspagnecarefour.com, carrefourspaine.com, carrefourspain.com and 5 others...	Transfer	Sept. 25, 2018
D2018-1599	Complainant	solitaire-euromaster.info	Transfer	Sept. 22, 2018
D2018-1598	Complainant	novotelbrisbane.com, accordhotelarena.com	Transfer	Sept. 10, 2018