Domain Names
1189 Domain Names
Rank
19th Rank.
Domain Name Dispute Cases with Domain Length: 22
You can also use the search page to filter the cases with domain length: 22.
Case NoDomain NameDecisionDecision Date
D2019-0047 closedoutletonlineshop.com Case active -
D2019-0022 cicimmobilier.org, cic-immobilier.online, agencesimmobilierescic.com and 3 others... Case active -
D2019-0005 grouponcustomerservice.com, grouponatlanta.com Case active -
D2018-2943 sistema-bancario-intesasanpaolo.com, sanpaolointesasbanca.com, sanpaolointesarecap.com and 32 others... Case active -
D2018-2933 grouponmerchantsupport.com Case active -
D2018-2919 air-france-reservation.com Case active -
D2018-2906 whatzepp.xyz, seslifacebook.com, instagramucuztakipci.com and 34 others... Case active -
D2018-2825 carrefour-hypermarches.com Case active -
D2018-2820 mobile-creditmutuel-fr.info, mobile-cic-fr.info, confirmationmobile-creditmutuel-fr.info Case active -
D2018-2784 slaterhoggconveyancing.com Case active -
D2018-2773 sexdatingchatroulette.com, masturbationchatroulette.com, masturbatingchatroulette.com and masturbatechatroulette.com Case active -
D2018-2758 gallerieslafayette-prive.com, galerieslafayetteprive.com, galerieslafayette-prive.com Case active -
D2018-2219 rebuiltmacktransmissions.org, rebuiltmacktransmissions.com, rebuiltmacktransmission.org and 18 others... Transfer Nov. 29, 2018
D2018-2210 virginunitefoundation.com, virginatlancticairways.com, neckerislandresorts.com Transfer Nov. 22, 2018
D2018-2204 centraleachatcarrefour.com Transfer Nov. 23, 2018
D2018-2159 comericatreasurymobile.com Transfer Nov. 19, 2018
D2018-2092 therenwickhotelnewyork.com Transfer Oct. 22, 2018
D2018-2088 travelocitycouponcodes.com Transfer Nov. 14, 2018
D2018-1960 badgleymischkaswimwear.com, badgleymischkaswim.com Transfer -
D2018-1930 accenturejobsplacement.com Transfer Oct. 18, 2018
D2018-1882 sofitelrabatjardindesroses.website, sofitelmarrakechpalaisimperial.website, sofitelmarrakechloungeandspa.website and 15 others... Transfer Oct. 5, 2018
D2018-1722 jasonhartmanproperties.com Transfer Sept. 24, 2018
D2018-1686 walkingforwardtogether.org Complaint denied Sept. 21, 2018
D2018-1662 bcbgmaxazriasaleoutlet.com Transfer Sept. 4, 2018
D2018-1661 bcbgmaxazriastore.com, bcbgmaxazriasale.com, bcbgmaxazriacheap.com and bcbgmaxazriabestonline.com Transfer Sept. 27, 2018