Domain Names
169 Domain Names
Rank
24th Rank.
Domain Name Dispute Cases Filled by ACCOR
You can also use the search page to filter the cases filled by ACCOR.
Case NoDomain NameDecisionDecision Date
D2019-0438 midaccor-mail.com Case active -
D2019-0408 shortingaccor.com, shortaccorhotels.com, shortaccor.com Case active -
D2019-0355 accorhotels-europe.com Case active -
D2019-0159 ibisstyleswalthamstow.xyz Case active -
DAU2019-0004 grandmercuredocklands.com.au Case active -
DAE2019-0002 sofitel.ae Case active -
D2018-2942 accorrhotel.com Transfer Feb. 1, 2019
D2018-2821 sofitel-asia.com Transfer Feb. 6, 2019
D2018-2780 accorlivelimitless.com Transfer Jan. 22, 2019
D2018-2732 swissotel-thestamford.com Transfer Feb. 9, 2019
D2018-2730 accorhospitality.org Terminated -
D2018-2593 allaccor.com, all-accor.com Terminated -
D2018-2380 sofitelbed.com, sofitel-bed.com Terminated -
D2018-2376 sofiteljjoriental.com Transfer Jan. 11, 2019
D2018-2329 accor5g.online, accorhotels5g.com Transfer Dec. 19, 2018
D2018-1882 sofitelrabatjardindesroses.website, sofitelmarrakechpalaisimperial.website, sofitelmarrakechloungeandspa.website and 15 others... Transfer Oct. 5, 2018
D2018-1754 accor.group Transfer Sept. 19, 2018
D2018-1736 swissotel-dubai.com Transfer Sept. 10, 2018
D2018-1733 accordeals.com, accordeal.com Transfer Oct. 3, 2018
D2018-1717 hotelnovotels.com Transfer Oct. 7, 2018
D2018-1650 pullman-baotou.com Terminated -
D2018-1645 fr-accorhotels.com Transfer Sept. 6, 2018
D2018-1623 sofitel.pub Transfer Aug. 29, 2018
D2018-1598 novotelbrisbane.com, accordhotelarena.com Transfer Sept. 10, 2018
D2018-1576 pgsofitel.com Transfer Sept. 18, 2018