Domain Names
169 Domain Names
Rank
24th Rank.
Domain Name Dispute Cases Filled by ACCOR
You can also use the search page to filter the cases filled by ACCOR.
Case NoDomain NameDecisionDecision Date
D2019-1395 accorhotels-asia.com Case active -
D2019-1206 accorjotels.com, accorhoteld.com Case active -
D2019-1204 accorhorels.com Case active -
D2019-1187 accoorr.com Case active -
D2019-0984 com-accorhotels.com Transfer June 11, 2019
D2019-0966 accorhotel-group.com Transfer June 14, 2019
D2019-0849 pullmanshanghai.com Transfer -
D2019-0842 aaccordhotels.com Transfer May 27, 2019
D2019-0438 midaccor-mail.com Transfer April 12, 2019
D2019-0408 shortingaccor.com, shortaccorhotels.com, shortaccor.com Transfer -
D2019-0355 accorhotels-europe.com Transfer April 17, 2019
D2019-0159 ibisstyleswalthamstow.xyz Transfer March 25, 2019
DAU2019-0004 grandmercuredocklands.com.au Transfer April 18, 2019
DAE2019-0002 sofitel.ae Transfer April 16, 2019
D2018-2942 accorrhotel.com Transfer Feb. 1, 2019
D2018-2821 sofitel-asia.com Transfer Feb. 6, 2019
D2018-2780 accorlivelimitless.com Transfer Jan. 22, 2019
D2018-2732 swissotel-thestamford.com Transfer Feb. 9, 2019
D2018-2730 accorhospitality.org Terminated -
D2018-2593 allaccor.com, all-accor.com Terminated -
D2018-2380 sofitelbed.com, sofitel-bed.com Terminated -
D2018-2376 sofiteljjoriental.com Transfer Jan. 11, 2019
D2018-2329 accor5g.online, accorhotels5g.com Transfer Dec. 19, 2018
D2018-1882 sofitelrabatjardindesroses.website, sofitelmarrakechpalaisimperial.website, sofitelmarrakechloungeandspa.website and 15 others... Transfer Oct. 5, 2018
D2018-1754 accor.group Transfer Sept. 19, 2018